Oncology / Hematology / Fertility

PEGylated Filgrastim (PEG-G-CSF)

Helvetic BioPharma is specialized in chemical modification of recombinant proteins. The production techniques for PEGfilgrastim have been designed to demonstrate biosimilarity to the PEGfilgrastim products globally marketed. PEGylation of a filgrastim can improve not only its formulation properties, but also both its pharmacokinetic and pharmacodynamic characteristics. Our goal is to provide our customers with reliable, high quality PEGfilgrastim products and we can execute fast and reliable PEGylation reaction (single use), with a novel process for purification and downstream processing with the industry’s highest quality standards.

Product Details

PEGfilgrastim is a PEGylated form of the recombinant human granulocyte colony-stimulating factor (GCSF) analog Filgrastim. It serves to stimulate the production of white blood cells (neutrophils). PEGfilgrastim treatment can be used to stimulate bone marrow to produce more neutrophils to fight infection in patients undergoing chemotherapy.

The conjugation of a methoxy polyethylene glycol (mPEG) chain to Filgrastim (r-metHu-G-CSF) results in a long-acting form of Filgrastim (mPEG-GCSF) that requires only once-per-cycle administration to patients suffering of chemotherapy-induced neutropenia.

  • MW = 39 kDa
  • Source: coli cells
  • Amino acid sequence: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

PEGfilgrastim is a covalent conjugate of recombinant methionyl human G-CSF (Filgrastim) and monomethoxypolyethylene glycol. Filgrastim is a water-soluble 175 amino acid protein with a molecular weight of approximately 19 kilodaltons (kD). Filgrastim is obtained from the bacterial fermentation of a strain of Escherichia coli transformed with a genetically engineered plasmid containing the human G-CSF gene.To produce PEGfilgrastim, a 20 kD monomethoxypolyethylene glycol molecule is covalently bound to the N-terminal methionyl residue of Filgrastim. The average molecular weight of PEGfilgrastim is approximately 39 kD.